PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007482m
Common NameCARUB_v10007482mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 379aa    MW: 43188.7 Da    PI: 8.9844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007482mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.7e-14145191148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W   Ed+ll + vk+ G+++W+ Ia+ ++ gR +kqc++rw+++l
  Carubv10007482m 145 KGQWNLAEDKLLRKMVKRIGTRRWTEIAKSFQ-GRVGKQCRERWHNHL 191
                      799*****************************.*************97 PP

2Myb_DNA-binding521.6e-16197239145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eEd++lv+ +kq G++ W+ Ia++++ gR+++ +k++w+
  Carubv10007482m 197 KNAWSEEEDQILVQIHKQVGNK-WTQIAKRLP-GRSENIVKNHWN 239
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.658140191IPR017930Myb domain
SMARTSM007172.3E-12144193IPR001005SANT/Myb domain
SuperFamilySSF466894.39E-28144238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-20146194IPR009057Homeodomain-like
PfamPF139211.6E-15148205No hitNo description
CDDcd001679.29E-12148191No hitNo description
PROSITE profilePS5129423.888192246IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-20195244IPR009057Homeodomain-like
SMARTSM007171.5E-14196244IPR001005SANT/Myb domain
CDDcd001672.17E-11199242No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MYHQNLISSV PNQISNPHNC VTQNHLFPIL PPNEIPSTYP FMGNSSYSNT DAFEGFQHNI  60
TGDLKFPKTY YTPFPVTSQG IPYDMHGFQV NPMLNDISHN QGNITGNHEP TLVHFMVESQ  120
QTNVSEPEEK VIIKTDQKKK GISHKGQWNL AEDKLLRKMV KRIGTRRWTE IAKSFQGRVG  180
KQCRERWHNH LRPDIQKNAW SEEEDQILVQ IHKQVGNKWT QIAKRLPGRS ENIVKNHWNA  240
TKRRLLSMKN KRSGALPPPN NTLENYIWST AVNNLNRGAV ANAEMENNKR ENVADGVMMN  300
LNLDATRQTA ATTSVYVPEK TVYTWGNLVG GRQNPATMMM DAYVPEKTAV PWGNDFTRVN  360
EPVDDDDAHE WMLMNGCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-381452444103C-Myb DNA-Binding Domain
1mse_C6e-381452444103C-Myb DNA-Binding Domain
1gv2_A7e-381452444103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285962.10.0hypothetical protein CARUB_v10007482mg
TrEMBLR0H2H40.0R0H2H4_9BRAS; Uncharacterized protein
STRINGAT5G40360.11e-140(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.11e-144myb domain protein 115